Instant entry access: Searches all entries on many criteria: Title, Author, Entity, Organism, Database code, etc. Hover over a result for more information.
Select polymer class:
Sequence: MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRK Please note that search for very short sequences may require higher expectation cutoff and is unlikely to produce meaningful results
Upper limit for expectation value (fasta -E NUM): default 10.0 15.0 20.0 30.0
I am not a robot